DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and Dido1

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_006235867.1 Gene:Dido1 / 362286 RGDID:1311173 Length:2258 Species:Rattus norvegicus


Alignment Length:255 Identity:61/255 - (23%)
Similarity:105/255 - (41%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IALAKTLIKN-------------WKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSIS 117
            :|.|||.:|.             |      |:.|....|:.:.|.:...:|||....:.:...|:
  Rat   579 MAGAKTAVKKLPSGFKGTIPKRPW------PSATLSGTSARQAGPTPVIAASKKLPGSAAVVGIA 637

  Fly   118 GKDKSSSSSSSKDKEKKGSTSSSQTSFPSGGMTDAVRIKCREML-----------ATALKIGEVP 171
            .|..|::..::.....:....|...|.|:..:...:|...:|:|           .|..::|:: 
  Rat   638 RKPMSANVPAASPVPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEVGKI- 701

  Fly   172 EGCGEPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMT 236
                     |..:|..:::.|..||.:||::.||.:.|||||||.||....:...::..:|.:|.
  Rat   702 ---------ALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRMK 757

  Fly   237 PEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEP 296
            |||:.|.|:....||..|..|.         ::|.||..:   |:|.|..:......|.|
  Rat   758 PEELVSKELSMWTEKPTKSVIE---------SRTKLLNES---KKNSTKPETIPDMEDSP 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 61/255 (24%)
TFS2N 7..82 CDD:197766 6/28 (21%)
TFIIS_M 151..257 CDD:284835 33/116 (28%)
Zn-ribbon_TFIIS 266..312 CDD:259796 8/31 (26%)
Dido1XP_006235867.1 TNG2 <157..299 CDD:227367
PHD_DIDO1_like 263..316 CDD:277109
TFS2M 671..772 CDD:128786 30/110 (27%)
SPOC 1046..1194 CDD:400205
SWIRM-assoc_1 <1465..1502 CDD:406808
PHA03247 <1564..2085 CDD:223021
SF-CC1 2144..>2182 CDD:273721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.