DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and Polr1h

DIOPT Version :10

Sequence 1:NP_476967.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_998732.1 Gene:Polr1h / 361784 RGDID:1303114 Length:123 Species:Rattus norvegicus


Alignment Length:102 Identity:27/102 - (26%)
Similarity:39/102 - (38%) Gaps:24/102 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATV-----------QGTK 269
            ||::...:|            |....|.:::....|.||.::...:|.||           ||..
  Rat    27 PGVQDTVIC------------PRCGFSIDVRDFGGKVVKTSVVFNKLGTVIPMSVDEGPESQGPV 79

  Fly   270 TDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMCNEC 306
            .| .:|::|......|...|.|||||..|.|..|..|
  Rat    80 VD-RRCSRCGHEGMAYYTRQMRSADEGQTVFYTCINC 115

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_476967.1 TFSII 5..313 CDD:273592 27/102 (26%)
Polr1hNP_998732.1 RPB9 16..115 CDD:441202 26/100 (26%)
Zn-ribbon_RPA12 76..122 CDD:259792 16/41 (39%)