DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and CG8117

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_573049.2 Gene:CG8117 / 32499 FlyBaseID:FBgn0030663 Length:162 Species:Drosophila melanogaster


Alignment Length:163 Identity:104/163 - (63%)
Similarity:134/163 - (82%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 MTDAVRIKCREMLATALKIGEVPEGCGEPEEMAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDP 213
            |:..:|||||||||||||.|.:|.|||:|::|||:||||||.:.|...:|||||||||:|||:||
  Fly     1 MSMEIRIKCREMLATALKSGNMPPGCGDPDDMAAKLEDAIYGDLNGCKVKYKNRIRSRLANLRDP 65

  Fly   214 KNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKC 278
            |||.||..|:.|.:|.::|:||||||||||:||::|:|:|:::||.||:|.|||||||..||.:|
  Fly    66 KNPELRQKFLLGQITPEELSKMTPEEMASDDMKQMRQKYVQDSINAAQMAKVQGTKTDQFKCERC 130

  Fly   279 KKRNCTYNQLQTRSADEPMTTFVMCNECGNRWK 311
            .||||  :||..|..|||:.|||:|:|||||||
  Fly   131 DKRNC--SQLHIRDGDEPIITFVICDECGNRWK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 104/163 (64%)
TFS2N 7..82 CDD:197766
TFIIS_M 151..257 CDD:284835 67/105 (64%)
Zn-ribbon_TFIIS 266..312 CDD:259796 30/46 (65%)
CG8117NP_573049.2 TFIIS_M 3..109 CDD:284835 67/105 (64%)
Zn-ribbon 118..161 CDD:295390 28/44 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472679
Domainoid 1 1.000 70 1.000 Domainoid score I3395
eggNOG 1 0.900 - - E1_COG1594
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1834
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 1 1.000 - - FOG0001112
OrthoInspector 1 1.000 - - mtm1141
orthoMCL 1 0.900 - - OOG6_101177
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2312
SonicParanoid 1 1.000 - - X770
1110.730

Return to query results.
Submit another query.