Sequence 1: | NP_001260457.1 | Gene: | TfIIS / 34883 | FlyBaseID: | FBgn0010422 | Length: | 313 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038950406.1 | Gene: | Med26 / 306328 | RGDID: | 1309524 | Length: | 609 | Species: | Rattus norvegicus |
Alignment Length: | 228 | Identity: | 50/228 - (21%) |
---|---|---|---|
Similarity: | 94/228 - (41%) | Gaps: | 61/228 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSS 92
Fly 93 AK-----EGSSNN-----------SSASKSTSAAKSSSSIS----------------GKDKSSSS 125
Fly 126 SSSKDKEKKGSTS---SSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGE--PEEMAAELE 185
Fly 186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGL 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TfIIS | NP_001260457.1 | TFSII | 5..313 | CDD:273592 | 50/228 (22%) |
TFS2N | 7..82 | CDD:197766 | 16/53 (30%) | ||
TFIIS_M | 151..257 | CDD:284835 | 17/70 (24%) | ||
Zn-ribbon_TFIIS | 266..312 | CDD:259796 | |||
Med26 | XP_038950406.1 | TFS2N | 47..107 | CDD:197766 | 16/56 (29%) |
Med26_M | 199..426 | CDD:406186 | 19/79 (24%) | ||
Med26_C | 428..607 | CDD:406185 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1594 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |