DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and Med26

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_038950406.1 Gene:Med26 / 306328 RGDID:1309524 Length:609 Species:Rattus norvegicus


Alignment Length:228 Identity:50/228 - (21%)
Similarity:94/228 - (41%) Gaps:61/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIKNWKRFLASPAPTTPNNSS 92
            |:::.:|:...|..:.|.:||:|..:|::||.:|::|:...||.|:::|::.:   .|...|..:
  Rat    53 LEVISSLERYPITKEALEETRLGKLINDVRKKTKNEELAKRAKRLLRSWQKLI---EPVHQNEVA 114

  Fly    93 AK-----EGSSNN-----------SSASKSTSAAKSSSSIS----------------GKDKSSSS 125
            .:     .||:|.           :.|.||....|:.:.|.                |..:....
  Rat   115 LRALAGAAGSANGGAHNCRPELGVAGAPKSIHDLKNRNDIQRLPGQRLDRLGSRKRRGDQRDLGH 179

  Fly   126 SSSKDKEKKGSTS---SSQTSFPSGGMTDAVRIKCREMLATALKIGEVPEGCGE--PEEMAAELE 185
            .....|..|||..   .:.:..|:.|::.:     .|.|.:.|      :|.|.  |:....||.
  Rat   180 PGPPHKVSKGSPDPLVPNASPLPTNGISGS-----PESLPSPL------DGSGHLGPDGSRLELS 233

  Fly   186 DAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGL 218
            :   :|.::|.:.. |.:|.|      |.:|||
  Rat   234 E---NEKHSTKIPV-NAVRPR------PSSPGL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 50/228 (22%)
TFS2N 7..82 CDD:197766 16/53 (30%)
TFIIS_M 151..257 CDD:284835 17/70 (24%)
Zn-ribbon_TFIIS 266..312 CDD:259796
Med26XP_038950406.1 TFS2N 47..107 CDD:197766 16/56 (29%)
Med26_M 199..426 CDD:406186 19/79 (24%)
Med26_C 428..607 CDD:406185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.