DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and RGD1305807

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001020447.1 Gene:RGD1305807 / 298077 RGDID:1305807 Length:621 Species:Rattus norvegicus


Alignment Length:53 Identity:16/53 - (30%)
Similarity:21/53 - (39%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KMSKMASDGTGQDQALDLLKA--------LQTL--NINLDILTKTRIGMTVNE 55
            |:.|.|..|.....|.....|        ||||  |..|.:|.|::.|.:..|
  Rat   558 KLQKTAKHGCPNQSAGPRFSARARTRWFLLQTLINNPRLAMLRKSKSGHSFRE 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 16/53 (30%)
TFS2N 7..82 CDD:197766 16/53 (30%)
TFIIS_M 151..257 CDD:284835
Zn-ribbon_TFIIS 266..312 CDD:259796
RGD1305807NP_001020447.1 RBP_receptor 13..602 CDD:291422 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.