DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and AT2G42725

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001324130.1 Gene:AT2G42725 / 28718350 AraportID:AT2G42725 Length:247 Species:Arabidopsis thaliana


Alignment Length:267 Identity:58/267 - (21%)
Similarity:113/267 - (42%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVEEEVFRIQKKMS--KMASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDD 63
            :.:.|...|..|.:.  |.:|..:....|.:.||...| ::..::::||.:|..::.| ...|:.
plant     7 LELYEAALRAAKSVKGVKNSSKVSRFVDARNRLKDAPT-SLACEVVSKTSMGKGLSFL-NDHKNP 69

  Fly    64 EVIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSS 128
            .:.:..:.|...|.:.|.:                                  ||::|      |
plant    70 HIRSEGRLLRDLWMKILYA----------------------------------SGREK------S 94

  Fly   129 KDKEKKGSTSSSQTSFPSGGMTDAVRIKCREMLATAL-KI-GEVPE--------GCGEPEEMAAE 183
            .|:|.:....:..|...:|   |:.|.|.||:|.|:| |: .|:.:        .| :|..:|..
plant    95 HDRETQVKIPTHSTMKKTG---DSKRDKVREILQTSLVKVASEIVDTEMKTRVTAC-DPSVVAVS 155

  Fly   184 LEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKL 248
            :|.|::.:.......:|.:.||.:.|:.|..||.||...:.|.:..::|..|..:||.|::::|.
plant   156 VESAMFEKLGCFMGPHKAKYRSILFNMGDSNNPDLRRKVLIGEINGERLVTMERQEMGSEKIQKE 220

  Fly   249 REKFVKE 255
            .:: :||
plant   221 VQR-IKE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 58/263 (22%)
TFS2N 7..82 CDD:197766 16/76 (21%)
TFIIS_M 151..257 CDD:284835 33/115 (29%)
Zn-ribbon_TFIIS 266..312 CDD:259796
AT2G42725NP_001324130.1 TFSII 14..233 CDD:273592 57/260 (22%)
TFS2M 118..223 CDD:128786 29/105 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1141
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.