DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and Tceanc

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001007578.2 Gene:Tceanc / 245695 MGIID:2685236 Length:359 Species:Mus musculus


Alignment Length:349 Identity:103/349 - (29%)
Similarity:169/349 - (48%) Gaps:59/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IQKKMSKMASDGTGQDQALDLLKALQTLNINLDILTKTRIGMTVNELRKSSKDDEVIALAKTLIK 74
            |::.:||...:..|:.     |..|:.:.::.:.|.:|.:...|..:.|:.....:...||.|:.
Mouse    14 IEQLVSKRYFEDIGKQ-----LTELEMIYVSKEHLQETDVVRAVYRVLKNCPSVTLKKKAKCLLA 73

  Fly    75 NWKRFLAS------PAP-TTPNNSSAKEGSSNNSSASKSTSAAKSSSSISGKDKSSSSSSSKDKE 132
            .|:.|..|      .:| ....|::.:|.::.:...|:..::..|.|.|.|...|.|....:|..
Mouse    74 KWRGFYKSTHCKPRQSPKVLHTNANKEESAAVSQDVSQDETSGSSHSEIMGLCSSLSRLLPQDAA 138

  Fly   133 KK----GSTSSSQ----------------TSFPSG---GMTDAVRIKCREMLATALKIGEVPEGC 174
            |.    ||.||:.                |...||   |...:||.||.|:|.|||     ...|
Mouse   139 KPAAAIGSESSTAQMEINEGYLKGDDSECTRKSSGVFQGTLVSVRSKCVELLYTAL-----ASSC 198

  Fly   175 GEPEE------MAAELEDAIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLA 233
            .:..|      :|.|:|:.|::..:|...|||..|||:|||||:|:|..|:.||:.|.::|::.|
Mouse   199 TDHTEVHIWQNLAREIEEHIFTLHSNNIKKYKTSIRSKVANLKNPRNFHLQQNFLSGTMSAREFA 263

  Fly   234 KMTPEEMASDEMKKLREKFVKEAINDAQL-ATVQGTKTDLLKCAKCKKRNCTY-----------N 286
            :|:..:|||.|:|:||..:.:.:|.:..| .:|.||.|:.:||.:|.|.||..           :
Mouse   264 EMSVLDMASQELKQLRASYTESSIQEHCLPQSVDGTWTNKIKCRRCDKYNCKVTVIARGTLFLPS 328

  Fly   287 QLQTRSADEPMTTFVMCNECGNRW 310
            .:|..:.||.| |:|:|||||.:|
Mouse   329 WVQNSNPDEQM-TYVICNECGEQW 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 103/349 (30%)
TFS2N 7..82 CDD:197766 15/71 (21%)
TFIIS_M 151..257 CDD:284835 43/111 (39%)
Zn-ribbon_TFIIS 266..312 CDD:259796 21/56 (38%)
TceancNP_001007578.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..118 4/33 (12%)
TFIIS_M 181..290 CDD:369395 44/113 (39%)
Zn-ribbon 298..351 CDD:383047 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1579101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11477
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.