DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and rpoa-12

DIOPT Version :10

Sequence 1:NP_476967.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_506572.1 Gene:rpoa-12 / 182648 WormBaseID:WBGene00007616 Length:119 Species:Caenorhabditis elegans


Alignment Length:98 Identity:27/98 - (27%)
Similarity:42/98 - (42%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 CGAVTAKQLAKMTPEEMASD------EMKKLREKFVK--EAINDAQLATVQGTKTDLLK------ 274
            |||:.  :|....|..::..      .:|:..::.|.  |.|.:..:|...|.:.|...      
 Worm    16 CGAIL--ELPAQAPATVSCKVCSTRWAVKERVDQVVSRVEKIYERTVADTDGIENDESADAVVDH 78

  Fly   275 -CAKCKKRNCTYNQLQTRSADEPMTTFVMCNEC 306
             |.||.....:|:.:|||||||..|.|..|.:|
 Worm    79 ICTKCGHSKASYSTMQTRSADEGQTVFYTCLKC 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_476967.1 TFSII 5..313 CDD:273592 27/98 (28%)
rpoa-12NP_506572.1 RPB9 12..118 CDD:441202 27/98 (28%)
Zn-ribbon_RPA12 74..117 CDD:259792 15/38 (39%)

Return to query results.
Submit another query.