powered by:
Protein Alignment TfIIS and rpc-11
DIOPT Version :9
Sequence 1: | NP_001260457.1 |
Gene: | TfIIS / 34883 |
FlyBaseID: | FBgn0010422 |
Length: | 313 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500076.1 |
Gene: | rpc-11 / 176950 |
WormBaseID: | WBGene00022309 |
Length: | 108 |
Species: | Caenorhabditis elegans |
Alignment Length: | 39 |
Identity: | 20/39 - (51%) |
Similarity: | 22/39 - (56%) |
Gaps: | 2/39 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 275 CAKCKKRNCTYNQLQTRSADEPMTTFVMC--NECGNRWK 311
|..|......:.||||||||||.|.|..| |.|.:|||
Worm 69 CPVCSHGRAYFMQLQTRSADEPSTIFYRCADNACAHRWK 107
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.