DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and RpII15

DIOPT Version :10

Sequence 1:NP_476967.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_317057.3 Gene:RpII15 / 1277585 VectorBaseID:AGAMI1_004566 Length:127 Species:Anopheles gambiae


Alignment Length:70 Identity:22/70 - (31%)
Similarity:34/70 - (48%) Gaps:11/70 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DEMKKLREKFVKEAINDAQLATVQGTKTDLLKCAKCKKRNCTYNQLQTRSADEPMTTFVMC--NE 305
            ||:..:    |.:.|:|..|     .:|:...|.||..|...:.|.|||.|:|.|..:.:|  :.
Mosquito    65 DELTHI----VPDVISDPTL-----PRTEEHACPKCSHREAVFFQAQTRRAEEEMRLYYVCTNSS 120

  Fly   306 CGNRW 310
            |.:||
Mosquito   121 CCHRW 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_476967.1 TFSII 5..313 CDD:273592 22/70 (31%)
RpII15XP_317057.3 None

Return to query results.
Submit another query.