DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and RpI12

DIOPT Version :10

Sequence 1:NP_476967.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_312581.4 Gene:RpI12 / 1273588 VectorBaseID:AGAMI1_008413 Length:114 Species:Anopheles gambiae


Alignment Length:33 Identity:15/33 - (45%)
Similarity:18/33 - (54%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 KCAKCKKRNCTYNQLQTRSADEPMTTFVMCNEC 306
            :|.||.....:|..||.|||||..|.|..|.:|
Mosquito    74 QCPKCGNDQMSYATLQLRSADEGQTVFFTCTKC 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_476967.1 TFSII 5..313 CDD:273592 15/33 (45%)
RpI12XP_312581.4 RPB9 5..109 CDD:441202 15/33 (45%)
Zn-ribbon_RPA12 67..113 CDD:259792 15/33 (45%)

Return to query results.
Submit another query.