Sequence 1: | NP_001260457.1 | Gene: | TfIIS / 34883 | FlyBaseID: | FBgn0010422 | Length: | 313 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011526806.1 | Gene: | DIDO1 / 11083 | HGNCID: | 2680 | Length: | 2276 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 58/260 - (22%) |
---|---|---|---|
Similarity: | 101/260 - (38%) | Gaps: | 77/260 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 LRKSSKDDE-------VIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSAS--------- 104
Fly 105 --KST-------SAAKSSSSISGKDKSSSSSSSKDKEKK--GSTS-------------------- 138
Fly 139 ------SSQTSFPSGGMTDAVRIKCREML-----------ATALKIGEVPEGCGEPEEMAAELED 186
Fly 187 AIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREK 251
Fly 252 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TfIIS | NP_001260457.1 | TFSII | 5..313 | CDD:273592 | 58/260 (22%) |
TFS2N | 7..82 | CDD:197766 | 7/32 (22%) | ||
TFIIS_M | 151..257 | CDD:284835 | 30/112 (27%) | ||
Zn-ribbon_TFIIS | 266..312 | CDD:259796 | |||
DIDO1 | XP_011526806.1 | TNG2 | <160..302 | CDD:227367 | |
PHD_DIDO1_like | 266..319 | CDD:277109 | |||
TFS2M | 708..809 | CDD:128786 | 29/110 (26%) | ||
SPOC | 1093..1199 | CDD:285043 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |