DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIS and DIDO1

DIOPT Version :9

Sequence 1:NP_001260457.1 Gene:TfIIS / 34883 FlyBaseID:FBgn0010422 Length:313 Species:Drosophila melanogaster
Sequence 2:XP_011526806.1 Gene:DIDO1 / 11083 HGNCID:2680 Length:2276 Species:Homo sapiens


Alignment Length:260 Identity:58/260 - (22%)
Similarity:101/260 - (38%) Gaps:77/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LRKSSKDDE-------VIALAKTLIKNWKRFLASPAPTTPNNSSAKEGSSNNSSAS--------- 104
            |.||:|:|.       .:|.:|............||   |.|...|:.|..|.:|:         
Human   563 LYKSTKEDRRSEEKAAAMAASKKTAPPGSAVGKQPA---PRNLVPKKSSFANVAAATPAIKKPPS 624

  Fly   105 --KST-------SAAKSSSSISGKDKSSSSSSSKDKEKK--GSTS-------------------- 138
              |.|       ||..||.:.:.:....:.:::....||  ||.:                    
Human   625 GFKGTIPKRPWLSATPSSGASAARQAGPAPAAATAASKKFPGSAALVGAVRKPVVPSVPMASPAP 689

  Fly   139 ------SSQTSFPSGGMTDAVRIKCREML-----------ATALKIGEVPEGCGEPEEMAAELED 186
                  |:..|.|:..:...:|...:|:|           .|..::|::          |..:|.
Human   690 GRLGAMSAAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEVGKI----------ALHIEK 744

  Fly   187 AIYSEFNNTDMKYKNRIRSRVANLKDPKNPGLRGNFMCGAVTAKQLAKMTPEEMASDEMKKLREK 251
            .:::.|..||.:||::.||.:.|||||||.||....:...::..:|.::.|||:.|.|:...:|:
Human   745 EMFNLFQVTDNRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKER 809

  Fly   252  251
            Human   810  809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIISNP_001260457.1 TFSII 5..313 CDD:273592 58/260 (22%)
TFS2N 7..82 CDD:197766 7/32 (22%)
TFIIS_M 151..257 CDD:284835 30/112 (27%)
Zn-ribbon_TFIIS 266..312 CDD:259796
DIDO1XP_011526806.1 TNG2 <160..302 CDD:227367
PHD_DIDO1_like 266..319 CDD:277109
TFS2M 708..809 CDD:128786 29/110 (26%)
SPOC 1093..1199 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.