DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ck and PLEKHH3

DIOPT Version :9

Sequence 1:NP_001285949.1 Gene:ck / 34882 FlyBaseID:FBgn0000317 Length:2167 Species:Drosophila melanogaster
Sequence 2:XP_016880602.1 Gene:PLEKHH3 / 79990 HGNCID:26105 Length:882 Species:Homo sapiens


Alignment Length:295 Identity:73/295 - (24%)
Similarity:120/295 - (40%) Gaps:60/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1153 GILRA-----ELRDEIYCQICKQLTNNPL---------KSSHARGWILLSLCVGC-FAPSEKFVN 1202
            |:|:.     .||||::.|:.|| |:.|.         ..:..|.|.||: |:.| |.|......
Human   378 GVLQTCRDLPALRDELFLQLAKQ-TSGPAGPPGLPATQDPAALRYWQLLT-CMSCTFRPGGAVRG 440

  Fly  1203 YLRAFIREGPPG--------YAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDG 1259
            :|...:......        ||.:..:.|.||..   |...||..|:.|...::.::..:.....
Human   441 HLLGHLERTEQALPDSELAEYARFIRKALGRTRG---RELVPSLAEISALSQRQELLCTVHCPGA 502

  Fly  1260 NTKTLLADSATTARELCNQLSDKISL-KDQFGFSLYIALFDKVSSLGSGGDHVMDAISQCEQYAK 1323
            ....:..||.|||.|:..:|..::.| :.:..|:||.....:..:| :||..|.|.:::.|..|.
Human   503 GACAVAIDSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERAL-AGGTLVADVLTRFENLAA 566

  Fly  1324 EQGAQERNAP---WRLFFRKEIFAPWHEPTH------DQVATNLIYQQ----VVRGVKFGEYRCD 1375
            |:...| ::|   |||..|      .|.|.|      |......:::|    ::||      |..
Human   567 EEAGLE-DSPDSGWRLCLR------LHGPLHPEGLSPDGHELPFLFEQAHALLLRG------RPP 618

  Fly  1376 KEED----LAMIAAQQYFIEYSTDMSMERLFTLLP 1406
            ..:|    ||.:..|....::|..:.:.||..|||
Human   619 PPDDTLRALAALRLQSLQRDFSPRVPLPRLDRLLP 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ckNP_001285949.1 MYSc 64..733 CDD:214580
MYSc_Myo7 77..721 CDD:276832
MyTH4 <1138..1245 CDD:214535 30/114 (26%)
B41 1251..1467 CDD:214604 43/174 (25%)
FERM_B-lobe 1355..1439 CDD:271216 14/60 (23%)
FERM_C1_MyoVII 1461..1559 CDD:270019
SH3 1560..1624 CDD:302595
MyTH4 1701..1849 CDD:214535
B41 1856..2068 CDD:214604
FERM_M 1966..2068 CDD:278785
FERM_C2_MyoVII 2064..2159 CDD:270020
PLEKHH3XP_016880602.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4229
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.