DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and RGN

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_004674.1 Gene:RGN / 9104 HGNCID:9989 Length:299 Species:Homo sapiens


Alignment Length:242 Identity:54/242 - (22%)
Similarity:87/242 - (35%) Gaps:74/242 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 NSILVFDLKTDTLLRRFTIPADQT-KEDSF---FANIVVDADRSE--CQDAFAYIPDLGA----- 234
            ||:|..|           |||.:. :.|||   ...:.:||..|.  .:.:..|:..:|.     
Human    27 NSLLFVD-----------IPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCAL 80

  Fly   235 -----YGVIVYSLRNDKSYRVKHNFFH---FDPLHGDFNVGGVNFQWTDGVFGLAVGPMN---PD 288
                 ..|::.::.|||    |:|.|:   .||. |.:..|.:..:....|.....|.:.   ||
Human    81 NWKEQSAVVLATVDNDK----KNNRFNDGKVDPA-GRYFAGTMAEETAPAVLERHQGALYSLFPD 140

  Fly   289 HSKDIYFHALASTKEFKVSNRVLQNESHVTAGDSYYDFKYVGDRGMNGQSTAEVFDPETGVIFYT 353
            |....||      .:..:||.:..:..|..       |.|:.  .::....|..:|.:||.|.  
Human   141 HHVKKYF------DQVDISNGLDWSLDHKI-------FYYID--SLSYSVDAFDYDLQTGQIS-- 188

  Fly   354 QVNKDAIACWNIKRPYTPDTQGLIDSDSHTLVFPNDMKIDNEGTIWV 400
                      |.:..|..:.:..|         |:.|.||.||.:||
Human   189 ----------NRRSVYKLEKEEQI---------PDGMCIDAEGKLWV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 54/242 (22%)
RGNNP_004674.1 SGL 16..264 CDD:400653 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.