DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and YBR053C

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_009609.1 Gene:YBR053C / 852342 SGDID:S000000257 Length:358 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:39/181 - (21%)
Similarity:59/181 - (32%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 WEANKLP--IDVQPQDQKT--------------PSGGRLDADKAQDAGIQLKDNSTVISTFRIQV 155
            |....:|  |.....||||              |.|..|..|:.    |.:|:::.  .:|....
Yeast   193 WNCLLIPNAIHWDESDQKTMYVTDSLNFTIWKCPGGDLLKRDEL----IDVKNSNN--QSFESPE 251

  Fly   156 DVCDRLWVLDTG------LADILGSPKQITPNSILVFDLKTDTLLRRFTIPADQTKEDSFFA--- 211
            .....:|....|      ...:..:.|      :.:|||....||:.|.:| :||...|...   
Yeast   252 PDGSAIWFSKDGKHSGFLFITVWSTSK------VQMFDLTNGKLLKEFILP-EQTPRVSCCCFVG 309

  Fly   212 -NIVVDADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFDPLH 261
             ::.|....:|..||.....|..  |..:|.:.|.....|........|||
Yeast   310 KDLFVTTANAEINDAVRTNTDKN--GGCIYKIPNVLDGNVPLESTKRQPLH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 26/124 (21%)
YBR053CNP_009609.1 YvrE 1..345 CDD:225921 35/166 (21%)
WD40 repeat 150..186 CDD:293791
WD40 repeat 199..248 CDD:293791 12/54 (22%)
WD40 repeat 259..294 CDD:293791 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.