DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and yellow-e

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster


Alignment Length:421 Identity:115/421 - (27%)
Similarity:190/421 - (45%) Gaps:51/421 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MVCLI--GAFSRIASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFV 74
            ::|.:  ...|:..:..|:....||.|.:::   |.:|.......|..:|.|..|:....:||||
  Fly     8 VICAVLWSPVSQALTPGLQVAKQWKLLRYNF---EPQAPVSDPNFYNPQNVLITGLAVTDDRIFV 69

  Fly    75 TVPRWKAGVAATLNYIDINSTEKSPKLHPYPSWEANKLPIDVQPQDQKTPSGGRLDADKAQDAGI 139
            ..|:..:||.:|::::.......||.|:.:|.|..:              :.||.|.:.:     
  Fly    70 ATPKLFSGVPSTVSWVSKAQFGDSPTLNAFPDWTFS--------------NTGRSDFNCS----- 115

  Fly   140 QLKDNSTVISTFRIQVDVCDRLWVLDTGLADILGSPKQITPNSILVFDLKTDTLLRRFTIPADQT 204
                :..:.|.:|::||.|:|:|:||.|::..|...:...|..|||.||.||.::||...|.:..
  Fly   116 ----DLILTSVYRLRVDSCNRIWLLDAGISRSLEDYEITCPPKILVVDLATDRVVRRIDFPPEVL 176

  Fly   205 KEDSFFANIVVDADRSE-CQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFDPLHGDFNVGG 268
            :.:|.|.|:|:|...:: |.|.|.||.|....|:|||....|.::||.|...:.||......:..
  Fly   177 RGESLFTNMVIDETTAKGCDDVFVYITDTVEPGIIVYDSGKDVTWRVSHPAMYPDPDFAQSEIHE 241

  Fly   269 VNFQWTDGVFGLAVGPMNPDHSKDIYFHALASTKEFKVSNRVLQNESHVTAG----DSYYDFKYV 329
            ..|...|||.||..    .:.:..:||..||:.:.|.|...||:      ||    ....|.|.|
  Fly   242 HRFVLMDGVVGLTF----DERTGVVYFQPLATDRVFSVHKNVLR------AGPLPDGKMLDVKLV 296

  Fly   330 GDRGMNGQSTAEVFDPETGVIFYTQVNKDAIACWNIKRPYTPDTQGLIDSDSHTLVFPNDMKI-- 392
            |.:...|...|  ..|....:.::.:::.|||.||   | |.:.|.::..|...|.|..|:..  
  Fly   297 GKKSSQGIGLA--VSPFDSSLIFSPLSETAIASWN---P-TTNQQSVLAFDRDQLQFVADITTTK 355

  Fly   393 DNEGTIWVLSDKMPTYLYKELDPSAVNYRIL 423
            ...|.|:.::.|...:..|.|:|:..|.||:
  Fly   356 SEPGVIYAIASKFHRFFLKNLNPNEFNNRIV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 87/283 (31%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 87/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449241
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.