DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and yellow-k

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:281 Identity:57/281 - (20%)
Similarity:106/281 - (37%) Gaps:58/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DNSTVISTFRIQVDVCDRLWVLDTGLADILGSPKQITPNSILVFDL-KTDTLLRRFTIPADQTKE 206
            |.|.|......|||...||||:|.|......||:      :.|||| :.:..|.|..........
  Fly    91 DCSLVQQAHWSQVDALSRLWVMDIGFPGSTCSPR------LFVFDLMRNNAELLRIDCGHHIGAN 149

  Fly   207 DSFFANIVVDADRSECQ-DAFAY-----IPDLGAYGVIV-----YSLRNDKSYRVKHNFFHFDPL 260
            |:.|..:.:......|: :...|     :|::.||.::.     .||.::|          ::.:
  Fly   150 DTHFLTVQMGPKSPGCEHERHIYFILGKVPEILAYDILEQTWHRLSLESNK----------YENM 204

  Fly   261 HGDFNVGGVNFQWTDGVFGLAVGPMNPDHSKDIYFHALASTKEFKVSNRVLQNESHVTAGDSYYD 325
            :..|.:..|:|     :||:....:..|...|:|     ||    |....::.:|.:.:......
  Fly   205 NQSFPIKPVDF-----IFGIQGELILSDQDGDLY-----ST----VDRLEIEGKSELASKPINNS 255

  Fly   326 FKYVGDRGMNGQSTAEVFDPETGVIFYTQVNKDAIA-CWNIKRPYTPDTQGLIDSDSHTLVFPND 389
            .|......:.|.|.:.:.| ..|.::|......|:. |..:..         |.::.:.:::...
  Fly   256 IKLTHLGSLLGSSRSMIID-NFGTLYYVIPKFGAVVRCAKLAN---------ITAEGNEIIYITS 310

  Fly   390 MKID-----NEGTIWVLSDKM 405
            ..|.     :...:|||||::
  Fly   311 KNIQQIFFTSNDALWVLSDRV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 54/276 (20%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.