DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and yellow-g

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster


Alignment Length:397 Identity:81/397 - (20%)
Similarity:136/397 - (34%) Gaps:86/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWKAGVAATLNYIDI 92
            |..|.....:..||....:.....:|.|:..|.:....:..::..||.:||:|.||..||..:::
  Fly    46 ELTFQLSGSSLHWPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKVNL 110

  Fly    93 NSTEKSPKLHPYPSWEANKLPIDVQPQDQKTPSGGRLDADKAQDAGIQLKDNSTVI-STFRIQVD 156
            ...|...|:.|||.|                              .||.:.|...: |...|.||
  Fly   111 KKGECLTKIAPYPCW------------------------------AIQEEGNCQALQSVVDIAVD 145

  Fly   157 VCDRLWVLDTGLADILGSPKQITPNSILVFDLKTDTLLRRFTIPADQTKEDSFFANIVVDADRSE 221
            ....||.||.|:.:.|..|.:.....|:..:.....:::...: :|....:|....|||  |.|:
  Fly   146 QNGLLWALDVGIVNTLEQPIRRCSPKIVAINTANHKVVKSIDL-SDLVTSESRLQFIVV--DYSK 207

  Fly   222 CQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFDPLHGDFNVGGVNFQWTDGVFGLAVGPMN 286
            ....|.|:.|.||..::||.:..:||||:                          |...|..|.:
  Fly   208 DNKPFVYVADAGARSILVYDITGNKSYRI--------------------------VLPKATAPTS 246

  Fly   287 ----------PDHSKDIYFHALASTKEFKVSNRVLQNESHVTAGDSYYDFKYVGDRGMNGQSTAE 341
                      ||.:..::|..|:|.:.:.:....|:      .|........||.:....|:...
  Fly   247 DVLYVALTSKPDGTSTLFFSYLSSPRLYSIKGEYLR------VGQGAGSIIDVGPKPYGKQAVLL 305

  Fly   342 VFDPETGVIFYTQVNKDAIACWN----IKRPYTPDTQGLIDSDSHTLVFPNDMKIDNEGTIWVLS 402
            ..|..|. :|:....::.|..|:    .|.....:.|...|....|.|.|...:.     :|.|.
  Fly   306 GADGGTS-LFFRYKGENDIYLWDSETCFKAANLQEVQRGGDCRLSTQVLPGHKRF-----MWALE 364

  Fly   403 DKMPTYL 409
            .....::
  Fly   365 SNFHDFI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 56/277 (20%)
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 56/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.