DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and yellow-d2

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster


Alignment Length:429 Identity:116/429 - (27%)
Similarity:194/429 - (45%) Gaps:49/429 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ASAK-LEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNR------IFVTVPRWK 80
            |||: ||..|....|..::|:|:....|..:|.|...:.:|:.|:.:...      ||||:||:.
  Fly    17 ASAQALESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFA 81

  Fly    81 AGVAATLNYIDINSTEKSPKLHPYPSWEANKLPIDVQPQDQKTPSGGRLDADKAQDAGIQLKDNS 145
            .||..:|.|:..........|..|||:|.:|             |.|              .|.:
  Fly    82 KGVPYSLAYVTNEMRPNGTLLQAYPSYEWHK-------------SHG--------------ADCN 119

  Fly   146 TVISTFRIQVDVCDRLWVLDTGLADILGSPKQITPNSILVFDLKTDTLLRRFTIPADQTKED-SF 209
            .:.|.:|.|:|.|.|:|:||:|..|.:    |..|..:...||::..:..::.:|....||. |.
  Fly   120 GLTSVYRTQIDECGRMWILDSGEIDFI----QHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSR 180

  Fly   210 FANIVVDADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFDPLHGDFNVGGVNFQWT 274
            |....|:.|...|...|.|:.|....|::||.:...:|:|:::.|.:..|..|.|.:.|.:||..
  Fly   181 FVTPTVELDPHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLW 245

  Fly   275 DGVFGLAVGPMNPDHSKDIYFHALASTKEFKVSNRVLQNESHVTAGD---SYYDFKYVGDRGMNG 336
            ||.....:.|......:.:|||:|:|..:..:...|:.|.|:....|   :...|:.:|.||  .
  Fly   246 DGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRG--S 308

  Fly   337 QSTAEVFDPETGVIFYTQVNKDAIACWNIKRPYTPDTQGLIDSDSHTLVFPNDMKI--DNEG--T 397
            |..|.... |:|.:....|...::..|||:..|:.....::..|...|.|.:.:||  ::||  .
  Fly   309 QCVAAAMS-ESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEE 372

  Fly   398 IWVLSDKMPTYLYKELDPSAVNYRILMGQNRDLIKGTPC 436
            :||||:::.......||...:|:||.....::|:.|.||
  Fly   373 LWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSGRPC 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 81/295 (27%)
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 81/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.