DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-c and yellow-b

DIOPT Version :9

Sequence 1:NP_001285947.1 Gene:yellow-c / 34879 FlyBaseID:FBgn0041713 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster


Alignment Length:435 Identity:164/435 - (37%)
Similarity:264/435 - (60%) Gaps:33/435 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MLSLGLMVCLIGAFSRIASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQN 70
            ||...|.:.|:.|.|.:|:..|...:.|:::.|.:..|:....|...|.:...|.:|.|:|...:
  Fly     1 MLRFRLGLLLLWAVSALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGH 65

  Fly    71 RIFVTVPRWKAGVAATLNYIDINST-EKSPKLHPYPSWEANKLPIDVQPQDQKTPSGGRLDADKA 134
            |:|||:|||:.||.|:|.|:|:|.| .|.|.|.|:|||:|:.|. :.:|:               
  Fly    66 RLFVTLPRWRDGVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQ-EAEPE--------------- 114

  Fly   135 QDAGIQLKDNSTVISTFRIQVDVCDRLWVLDTGLADILGSPKQITPNSILVFDLKTDTLLRRFTI 199
                        ::|.||::.|.|.||||||:.::.:|...|......:||:||..|.||||..:
  Fly   115 ------------LVSPFRVRADRCGRLWVLDSRISGVLEQTKIYGAAQLLVYDLHNDDLLRRHVL 167

  Fly   200 PADQTKEDSFFANIVVDADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFDPLHGDF 264
            ||.|.|:.|..||:.|  :.|:|::.|||..|||:.|::|||.::::|:||:|:|||.||:.|:|
  Fly   168 PAGQLKQGSLLANLAV--EDSDCENTFAYAADLGSPGLVVYSWKDEESWRVQHHFFHPDPMAGNF 230

  Fly   265 NVGGVNFQWTDGVFGLAVG-PMNPDHSKDIYFHALASTKEFKVSNRVLQNESHVTAGDSYYDFKY 328
            ::.|:.|||.||::|||:. |:...:: .:|||.|.||.||.|...:|:|::..|:...|.:||.
  Fly   231 SINGIEFQWDDGLYGLALSKPLETGYA-TLYFHPLCSTTEFSVDTSILRNKTLATSPMIYREFKV 294

  Fly   329 VGDRGMNGQSTAEVFDPETGVIFYTQVNKDAIACWNIKRPYTPDTQGLIDSDSHTLVFPNDMKID 393
            :|.||.|.|:.||..||:|||:||...|.:.:|||.....::..:|..|..::.|||||:|:|:|
  Fly   295 LGSRGPNTQAGAEFLDPDTGVLFYALPNLNEVACWRTATDFSHSSQSRIHMNNDTLVFPSDIKVD 359

  Fly   394 NEGTIWVLSDKMPTYLYKELDPSAVNYRILMGQNRDLIKGTPCEM 438
            ::..:||||:::|.::|.||...::|:|||....::.|:.|.||:
  Fly   360 DQKRLWVLSNQLPVFIYDELYAGSINFRILTASVKEAIENTACEI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-cNP_001285947.1 MRJP 148..436 CDD:281074 120/288 (42%)
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 120/288 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449199
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23419at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.