DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and CG11703

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_650792.1 Gene:CG11703 / 42307 FlyBaseID:FBgn0038690 Length:353 Species:Drosophila melanogaster


Alignment Length:172 Identity:37/172 - (21%)
Similarity:63/172 - (36%) Gaps:53/172 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 FYVVAARRVLCEMYKQQLYGRAHVWFFIGWY--------EDNWYEVNLKA-EGITCTVEQMR--I 284
            ||:|....::|           .|.|::|.:        :..|    ||. .|::....|.|  :
  Fly    58 FYLVLYALIVC-----------IVAFWLGIFMLAIIDPNKPRW----LKGPPGLSMVPNQNRSVL 107

  Fly   285 AAEGHLTTEALMWNQNNQTTISGMTAEEFRHRLNQALIEEGYDINHDRYPEGY-QEAPLAYDAVW 348
            |...|:.:|.        ..|:. ..::|.::||...|:...|.|.|. ..|| .|.|       
  Fly   108 AYFTHIMSEV--------NPIAD-RIDDFLNKLNDNAIDFFADFNQDT-TWGYATEKP------- 155

  Fly   349 SVALAFNKTMERLTTGKKSLRDFTY-TDKEIADEIYAAMNST 389
            :|.:..||.:..:..        || |..::..|..|::..|
  Fly   156 TVFIKLNKVIGYVPE--------TYDTPDDLPKEAPASLQDT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361 37/172 (22%)
ANF_receptor 52..415 CDD:279440 37/172 (22%)
7tm_3 476..730 CDD:278433
CG11703NP_650792.1 Na_K-ATPase 32..267 CDD:298651 37/172 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.