powered by:
Protein Alignment GABA-B-R1 and nrv3
DIOPT Version :9
Sequence 1: | NP_001246033.1 |
Gene: | GABA-B-R1 / 34878 |
FlyBaseID: | FBgn0260446 |
Length: | 841 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001260675.1 |
Gene: | nrv3 / 35408 |
FlyBaseID: | FBgn0032946 |
Length: | 313 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 16/60 - (26%) |
Similarity: | 20/60 - (33%) |
Gaps: | 25/60 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 GFKLIL-HSNDSECEPGLGAS------------------------VMYNLLYNKPQKLML 107
|||..| :|..|:|....|:| |.|..|.|:..|.||
Fly 21 GFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEKPKWML 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3927 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.