DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and Shbg

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_006246648.1 Gene:Shbg / 24775 RGDID:3671 Length:445 Species:Rattus norvegicus


Alignment Length:214 Identity:43/214 - (20%)
Similarity:72/214 - (33%) Gaps:97/214 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSDGAVTFWI---FLLCLIASPHLQGGVAGRPD---ELHIGGI--------FPIA-------GK 44
            |..| ::..|:   .:|||   ..:...:|..|.   .:.:||:        ||:.       .:
  Rat   179 MNGD-SLLLWVDGKEMLCL---RQVSASLADHPQLSMRIALGGLLLPTSKLRFPLVPALDGCIRR 239

  Fly    45 GGWQGGQACM-PAARLALD--DVNKQPNL--------------LP-------------GFKLI-- 77
            ..|.|.||.: .:||.:|.  ||:.||.|              :|             ||||:  
  Rat   240 DIWLGHQAQLSTSARTSLGNCDVDLQPGLFFPPGTHAEFSLQDIPQPHTDPWTFSLELGFKLVDG 304

  Fly    78 -----------------LHSND------SECEPGLGASV-----------MYNLLYNKPQKLMLL 108
                             ||..|      ||.||.|...:           ::.:..::..|:.:|
  Rat   305 AGRLLTLGTGTNSSWLTLHLQDQTVVLSSEAEPKLALPLAVGLPLQLKLDVFKVALSQGPKMEVL 369

  Fly   109 AGCSTVCTTVAEAAKMWNL 127
            :      |::...|.:|.|
  Rat   370 S------TSLLRLASLWRL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361 35/175 (20%)
ANF_receptor 52..415 CDD:279440 28/142 (20%)
7tm_3 476..730 CDD:278433
ShbgXP_006246648.1 Laminin_G_1 118..248 CDD:278483 15/72 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.