DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and ATP1B4

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001135919.1 Gene:ATP1B4 / 23439 HGNCID:808 Length:357 Species:Homo sapiens


Alignment Length:44 Identity:14/44 - (31%)
Similarity:20/44 - (45%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 DKAESKYNPDSAISKEDEER---YQKLVTENEELQRLITQKEEK 778
            |:|...|..|.....|:|.|   ..|...|.||.::...::|||
Human    25 DEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEKEEEEEEEK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433
ATP1B4NP_001135919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..80 14/44 (32%)
Na_K-ATPase 82..351 CDD:306737
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.