DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and Shbg

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_035497.1 Gene:Shbg / 20415 MGIID:98295 Length:403 Species:Mus musculus


Alignment Length:233 Identity:50/233 - (21%)
Similarity:73/233 - (31%) Gaps:105/233 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSDGAVTFWI---FLLCL-----IASPHLQGGVAGRPDELHIGGI--------FPIA------- 42
            |..| ::..|:   .:|||     ..:.|.|     |...:.:||:        ||:.       
Mouse   137 MNGD-SLLLWVDGKEMLCLRQISASLADHSQ-----RSMRIALGGLLLPTSKLRFPLVPALDGCI 195

  Fly    43 GKGGWQGGQA---CMPAARLALDDVNKQPNL--------------LP-------------GFKLI 77
            .:..|.|.||   ..|...|...||:.||.|              :|             ||||:
Mouse   196 RRDIWLGHQAQLSASPRTSLGNCDVDLQPGLFFPPGTHAEFSLQDIPQPHADPWTFSLELGFKLV 260

  Fly    78 -------------------LHSND------SECEPGLGASVMYNLLYNKPQKLMLLAGCSTVCTT 117
                               :|..:      ||.||    .|:..|....|.:|.|    ..|...
Mouse   261 DGSGQLLALGTGTNSSWLNIHLQNQSVVLSSEAEP----KVVLPLDVGLPLQLTL----DRVKVV 317

  Fly   118 VAEAAKMWNLIVLCYGASSPALSDRKRFPTLFR--THP 153
            :::..||   .||......||        :|:|  :||
Mouse   318 LSQGPKM---EVLSMSLLRPA--------SLWRLWSHP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361 41/192 (21%)
ANF_receptor 52..415 CDD:279440 34/159 (21%)
7tm_3 476..730 CDD:278433
ShbgNP_035497.1 Laminin_G_1 76..206 CDD:333802 16/74 (22%)
LamG 225..369 CDD:389952 27/139 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.