DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and GPR156

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_694547.2 Gene:GPR156 / 165829 HGNCID:20844 Length:814 Species:Homo sapiens


Alignment Length:423 Identity:100/423 - (23%)
Similarity:187/423 - (44%) Gaps:56/423 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 RTIVT---HVLRTVS--LPLFV-CMCTISSCGIFVAFALIIFNIWNKHRRVIQSSHPVCNTIMLF 508
            :|.:|   |..:|:|  .|:.: .:.|..|||:.:....:.|.|..:..|:::.|.|..|.:.|.
Human    29 KTTITSSHHSSKTISSLSPVLLGIVWTFLSCGLLLILFFLAFTIHCRKNRIVKMSSPNLNIVTLL 93

  Fly   509 GVIICLISVILLGIDGRFVSPEEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHRFTTKAKTDPK 573
            |..:...|..|.||....|. .....:.|.|..:|..|.:|.:|.:..|.||:::..|:...|.:
Human    94 GSCLTYSSAYLFGIQDVLVG-SSMETLIQTRLSMLCIGTSLVFGPILGKSWRLYKVFTQRVPDKR 157

  Fly   574 KKVEPWKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFPLEDPVSTTDDIKIRPELEH-CESQR 637
            ..::..:|..:|:.||..|:::|::|.:.||:| .|:...:...| |..|:.......| |.|:.
Human   158 VIIKDLQLLGLVAALLMADVILLMTWVLTDPIQ-CLQILSVSMTV-TGKDVSCTSTSTHFCASRY 220

  Fly   638 NSMWLGLVYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQ 702
            :.:|:.|::|.|||:|::|.:||..|..:....:|.|..:.:.:..:|:...:...|...:.|..
Human   221 SDVWIALIWGCKGLLLLYGAYLAGLTGHVSSPPVNQSLTIMVGVNLLVLAAGLLFVVTRYLHSWP 285

  Fly   703 DASFAFVALAVIFCCFLSMLLIFVPKV---------IEVIRH-------PKDKAESKYNPDSAIS 751
            :..|...:..:..|.......||:|::         .:.||.       |.....::|.      
Human   286 NLVFGLTSGGIFVCTTTINCFIFIPQLKQWKAFEEENQTIRRMAKYFSTPNKSFHTQYG------ 344

  Fly   752 KEDEERYQKLVTENEELQRLITQK-------EEKIRVLRQRLVERGDAKGT-EL-NGATGVASAA 807
             |:|..:.:  .|...::||:|:|       :|::...::::|....|:.| :| .||       
Human   345 -EEENCHPR--GEKSSMERLLTEKNAVIESLQEQVNNAKEKIVRLMSAECTYDLPEGA------- 399

  Fly   808 VATTSQPASLINSSAHATPAA-TLAITQDTHEH 839
                :.|||..|....|..:. |||..|....|
Human   400 ----APPASSPNKDVQAVASVHTLAAAQGPSGH 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 62/263 (24%)
GPR156NP_694547.2 7tm_3 71..312 CDD:278433 61/243 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..545 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 557..724
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 769..792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.