DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and Atp1b1

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_033851.1 Gene:Atp1b1 / 11931 MGIID:88108 Length:304 Species:Mus musculus


Alignment Length:294 Identity:51/294 - (17%)
Similarity:90/294 - (30%) Gaps:110/294 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 IWNKHRR-VIQSSHPVCNTIMLFGVII--CLISVILLGIDGRFVSPEEYPKICQARAWLLSTGFT 548
            |||..:: .:..:......|:||.||.  ||..:.:..|....::..|.....|.|  :...|.|
Mouse    16 IWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDR--VAPPGLT 78

  Fly   549 LAYGAMFSKVWRVHRFTTKAKTDPKKKVEPWKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFP 613
                    ::.::.:.....:.:..|..|.:.|                  .|...|::|.::..
Mouse    79 --------QIPQIQKTEISFRPNDPKSYEAYVL------------------NIIRFLEKYKDSAQ 117

  Fly   614 LEDPV-----STTDDIKIRPELEHCESQRNSM-----WLGLVYGFKGLILVFGLFLAYETRSIKV 668
            .:|.:     :...:.|.|.::.|...:|...     |||...|                     
Mouse   118 KDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSG--------------------- 161

  Fly   669 KQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIEVI 733
              :||..|.    |.....|:|..                          |:.:|.|.||     
Mouse   162 --LNDDSYG----YREGKPCIIIK--------------------------LNRVLGFKPK----- 189

  Fly   734 RHPKDKA------ESKYNPD----SAISKEDEER 757
             .||:::      ..||||:    ....|.||::
Mouse   190 -PPKNESLETYPLMMKYNPNVLPVQCTGKRDEDK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 42/255 (16%)
Atp1b1NP_033851.1 Na_K_ATPase_bet 1..304 CDD:273446 51/294 (17%)
immunoglobulin-like. /evidence=ECO:0000250 191..304 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.