DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABA-B-R1 and gpr156

DIOPT Version :9

Sequence 1:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster
Sequence 2:XP_005167483.1 Gene:gpr156 / 101885196 ZFINID:ZDB-GENE-060201-2 Length:800 Species:Danio rerio


Alignment Length:409 Identity:99/409 - (24%)
Similarity:189/409 - (46%) Gaps:46/409 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 RTVSLPLFVCMCTISSCGIFVAFALIIFNIWNKHRRVIQSSHPVCNTIMLFGVIICLISVILLGI 522
            |::|..|...:.|:.||||.:|...:||.:..|:.|:::.|.|..|.:.|.|.::...|..|..|
Zfish    47 RSLSPALRAVVWTLLSCGILLALFFLIFTLRFKNNRIVKMSSPNLNVLTLCGSVLTYSSGFLFAI 111

  Fly   523 DGR-FVSPEEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHRFTTKAKTDPKKKVEPWKLYTMVS 586
            :.: .:|......:.|||.|.|..|.:|.:|.:..|.||::|..|:...|.:..:...:|..:|:
Zfish   112 EEKSLLSGAGARAVLQARMWTLCIGSSLVFGPILGKTWRLYRVFTQRVPDKRVIIRDIQLMGLVA 176

  Fly   587 GLLSIDLVILLSWQIFDP------LQRYLETFPLEDPVSTTDDIKIRPELEHCESQRNSMWLGLV 645
            .|:.:|:|:|.:|.:.||      :...::...|:...|.:       :|:.|.|..:.:|:.|:
Zfish   177 LLVLVDIVVLTAWGLMDPAKCSRSVSAMVKVIDLDSSYSLS-------QLDSCSSLYSHLWIILI 234

  Fly   646 YGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQDASFAFVA 710
            ...||.:|::|.:||..|.::.:..:|.|:.:..::..|.:...:..|:.:.:.|..:..::.::
Zfish   235 SVLKGSLLLYGTYLAGLTSNVSLPPVNQSKTIMGAVCLVTMSSAVAVPISLYLYSWPNVVYSVIS 299

  Fly   711 LAVIFCCFLSMLLIFVPKVI-------EVIRHPKDKAESKYNPD---SAISKEDEERYQKLVTEN 765
            .|:..|......|:|||::.       |...||...|:...:|.   :::..|||..|  |:.||
Zfish   300 GAIFICTMAINCLLFVPQLTQWRHFEEETNSHPSQMAKYFSSPSKTTNSMYSEDEIYY--LLGEN 362

  Fly   766 EELQRLITQKEE-----------------KIRVLRQRLVERG-DAKGTELNGATGVASAAVATTS 812
            :.::|||.:|..                 |:....|.|.||. |:..|.||..:  ....|.:..
Zfish   363 DSMKRLINEKNAVIDSLQEQVNNAKDKLLKLMTASQLLDEREMDSSNTNLNSTS--TQTTVVSPD 425

  Fly   813 QPASLINSSAHATPAATLA 831
            .|..::...:...|...|:
Zfish   426 SPTLVLKQYSEVAPTRVLS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 63/260 (24%)
gpr156XP_005167483.1 7tm_3 65..318 CDD:278433 63/259 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.