DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnmt and AT3G52210

DIOPT Version :9

Sequence 1:NP_523568.2 Gene:Rnmt / 34877 FlyBaseID:FBgn0286027 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001030844.1 Gene:AT3G52210 / 824386 AraportID:AT3G52210 Length:355 Species:Arabidopsis thaliana


Alignment Length:295 Identity:78/295 - (26%)
Similarity:122/295 - (41%) Gaps:66/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VLDMCCGKGGDLLKWEKAAISH---LICTDIAEVSVEQC---QRRYQDILQRSEKSKFANKFTAE 197
            |.::.||...:..|||.|.|.|   ::.|.....||.:.   ||:..|:               |
plant    35 VCELYCGGAPETDKWEAAPIGHYIGIVDTSSGISSVREAWESQRKNYDV---------------E 84

  Fly   198 FFACDSTL----VRLRERYKDPSLQLNLVSCQFAFHYCFESMAQADCMMRNAAECLKPGGFFIAT 258
            ||..|.:.    ::|:::.:    |.:||||......|||:...|..::.|.|..|||||:|...
plant    85 FFEADPSKDDFEIQLQKKLE----QADLVSCWRHLQLCFETEESARRLLTNVACLLKPGGYFFGI 145

  Fly   259 MPDAYEIIRRLR--------AAGPDARRFGN----DVYSIEFDCETDPLPLFGAKYQFHLEGVVD 311
            .||:..|..:.:        .:|.....|.|    :.|.|.|:.|.:..||||.:||....|...
plant   146 TPDSSTIWAKYQKNVEAYHNRSGAKPNVFPNYIRSESYMITFELEEEKFPLFGKRYQLKFSGDNA 210

  Fly   312 CPEF-LVHFPTLVKLGRKYGLQLLKRSTFADYYKENLHHGRHLLQRMSGLESVQPQRCENDEEFA 375
            ..:. |||||:|::|.|:.||:.::..:..|:|.:|......||.. :|...|.|:         
plant   211 SEDHCLVHFPSLIRLAREAGLEFVEIQSLTDFYDDNRAQFASLLMN-AGPNFVDPR--------- 265

  Fly   376 HVSNFQGAQRSRSVGTLSKSEWEAATLYLVCAFKK 410
                          |.|....::...||....|:|
plant   266 --------------GKLLPRAFDLLGLYATFIFQK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RnmtNP_523568.2 Pox_MCEL 72..411 CDD:281307 78/295 (26%)
AT3G52210NP_001030844.1 AdoMet_MTases 21..286 CDD:302624 77/293 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390749at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.