DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment THG and THG1L

DIOPT Version :9

Sequence 1:NP_001188815.1 Gene:THG / 34876 FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_060342.2 Gene:THG1L / 54974 HGNCID:26053 Length:298 Species:Homo sapiens


Alignment Length:265 Identity:145/265 - (54%)
Similarity:187/265 - (70%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65
            ||.|:||||:.||.||:.|.:.|:|:|:||:.||:|::.|:|.||||..||.:|...|..||:|.
Human    30 MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEEL 94

  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129
            .|||:||||||||||||:::|..||||::|.:|:|.|.|:||||..|..:. :.||.|.|.||||
Human    95 EDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGR 159

  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194
            ||:|||.|.|||||||||||.|:||||||.||.|:.:.|||..||:.:|:||.:|||||:||.||
Human   160 VVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEF 224

  Fly   195 GINYNNLPAMYRKGTILLRKRV-------------ILGEK-----SRQAVVPLHEDLISSQFWKE 241
            .|||||...||||||:|:.::|             :.|:|     :|...||||.|:|...||||
Human   225 NINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKE 289

  Fly   242 HTEIL 246
            |.|||
Human   290 HPEIL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
THGNP_001188815.1 Thg1 2..239 CDD:226508 136/255 (53%)
Thg1 9..134 CDD:282322 67/125 (54%)
Thg1C 137..234 CDD:291110 60/114 (53%)
THG1LNP_060342.2 Thg1 31..291 CDD:226508 140/259 (54%)
Thg1 38..164 CDD:282322 67/125 (54%)
Thg1C 167..282 CDD:291110 60/114 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159418
Domainoid 1 1.000 158 1.000 Domainoid score I4107
eggNOG 1 0.900 - - E1_COG4021
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5959
Inparanoid 1 1.050 296 1.000 Inparanoid score I2751
Isobase 1 0.950 - 0 Normalized mean entropy S995
OMA 1 1.010 - - QHG54375
OrthoDB 1 1.010 - - D1152974at2759
OrthoFinder 1 1.000 - - FOG0004478
OrthoInspector 1 1.000 - - oto88514
orthoMCL 1 0.900 - - OOG6_103009
Panther 1 1.100 - - LDO PTHR12729
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1510
SonicParanoid 1 1.000 - - X3173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.