DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and HAP3

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_009532.1 Gene:HAP3 / 852260 SGDID:S000000117 Length:144 Species:Saccharomyces cerevisiae


Alignment Length:113 Identity:35/113 - (30%)
Similarity:63/113 - (55%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LPRASINKIIKE-LVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHVLEALE 83
            ||..::.:::|. |.|:.:|:.:::|.:..|.||.|..::|||::.|....:||||.|.:|.:|.
Yeast    42 LPINNVARLMKNTLPPSAKVSKDAKECMQECVSELISFVTSEASDRCAADKRKTINGEDILISLH 106

  Fly    84 RLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQE 131
            .|||.:|.:..:..|       ||.|:|.. |:|      :|:.:|.:
Yeast   107 ALGFENYAEVLKIYL-------AKYRQQQA-LKN------QLMYEQDD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 35/113 (31%)
HAP3NP_009532.1 HHT1 23..115 CDD:224947 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.