DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and NCB2

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_010685.1 Gene:NCB2 / 852006 SGDID:S000002805 Length:146 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:45/127 - (35%)
Similarity:82/127 - (64%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAEDDELTLPRASINKIIKELV-PTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINA 75
            :.:.|.::||:|::.|:|.|:: ..:....::||:|:|...|||.::||.|:|:.:...||||..
Yeast     2 AGDSDNVSLPKATVQKMISEILDQDLMFTKDAREIIINSGIEFIMILSSMASEMADNEAKKTIAP 66

  Fly    76 EHVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAR 137
            |||::|||.|.::::....|.:|.:.|.....:..:.::.:..|:.||||||||:|||.::|
Yeast    67 EHVIKALEELEYNEFIPFLEEILLNFKGSQKVKETRDSKFKKSGLSEEELLRQQEELFRQSR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 44/120 (37%)
NCB2NP_010685.1 COG5150 1..146 CDD:227479 45/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344315
Domainoid 1 1.000 51 1.000 Domainoid score I2882
eggNOG 1 0.900 - - E1_COG5150
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38809
Inparanoid 1 1.050 87 1.000 Inparanoid score I1574
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55130
OrthoFinder 1 1.000 - - FOG0004284
OrthoInspector 1 1.000 - - oto99678
orthoMCL 1 0.900 - - OOG6_103431
Panther 1 1.100 - - LDO PTHR46138
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R797
SonicParanoid 1 1.000 - - X3019
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.