DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and NF-YB4

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_172377.1 Gene:NF-YB4 / 837424 AraportID:AT1G09030 Length:139 Species:Arabidopsis thaliana


Alignment Length:130 Identity:34/130 - (26%)
Similarity:69/130 - (53%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDELTLPRASINKIIKELVPT-VRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHV 78
            |::..||.|::.:::|:::|: .:::.|:::.:..|.:|||..::.||:|.|:..|:||:|.:.:
plant     3 DEDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASEKCHRENRKTVNGDDI 67

  Fly    79 LEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLR----QQQELFAKAREE 139
            ..||..||..:|.......||..:|...:|...:....:.|..:|...|    .|...|.:..|:
plant    68 WWALSTLGLDNYADAVGRHLHKYREAERERTEHNKGSNDSGNEKETNTRSDVQNQSTKFIRVVEK 132

  Fly   140  139
            plant   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 33/124 (27%)
NF-YB4NP_172377.1 CBFD_NFYB_HMF 6..71 CDD:395650 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.