DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and NF-YB6

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001318754.1 Gene:NF-YB6 / 834818 AraportID:AT5G47670 Length:234 Species:Arabidopsis thaliana


Alignment Length:108 Identity:38/108 - (35%)
Similarity:64/108 - (59%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNPQEELLPPSAEDDELTLPRASINKIIKELVPT-VRVANESRELILNCCSEFIHLISSEANEVC 65
            ||..||  ..:..:.:..:|.|::.:|::.::|. .:::::|:|.|..|.||:|..|:.||||.|
plant    47 SNGGEE--ECTVREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERC 109

  Fly    66 NMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHDCKEVAAKR 108
            ....:|||.||.||.|:.:|||.||.:.....||..:|:..:|
plant   110 QREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGER 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 34/95 (36%)
NF-YB6NP_001318754.1 CBFD_NFYB_HMF 61..126 CDD:395650 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.