DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and NF-YB12

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_568190.1 Gene:NF-YB12 / 830715 AraportID:AT5G08190 Length:163 Species:Arabidopsis thaliana


Alignment Length:162 Identity:68/162 - (41%)
Similarity:103/162 - (63%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ELLPPSAEDDELTLPRASINKIIKELVPT-VRVANESRELILNCCSEFIHLISSEANEVCNMRNK 70
            :::..|.||  .:||:|::.|||||::|. ||||.::::|::.||.|||:|||||:|||||..:|
plant     5 DIVGKSKED--ASLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLISSESNEVCNKEDK 67

  Fly    71 KTINAEHVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLG--IPEEELLRQQQELF 133
            :||..||||:||:.|||.:|.:|..|.....|....:..::|.:: |.|  :.|||...:||.:|
plant    68 RTIAPEHVLKALQVLGFGEYVEEVYAAYEQHKYETMQDSQRSVKM-NSGAEMTEEEAAAEQQRMF 131

  Fly   134 AKAR-----------EEQARE-EQQQWMSMQA 153
            |:||           .||..| :|||..|:|:
plant   132 AEARARMNGGVTVPQPEQLEEPQQQQQTSLQS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 55/122 (45%)
NF-YB12NP_568190.1 H4 8..139 CDD:419976 60/133 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2953
eggNOG 1 0.900 - - E1_COG5150
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38809
Inparanoid 1 1.050 110 1.000 Inparanoid score I2066
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1465912at2759
OrthoFinder 1 1.000 - - FOG0004284
OrthoInspector 1 1.000 - - otm3304
orthoMCL 1 0.900 - - OOG6_103431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3019
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.