DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and Dr1

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001011914.1 Gene:Dr1 / 289881 RGDID:1305201 Length:176 Species:Rattus norvegicus


Alignment Length:171 Identity:106/171 - (61%)
Similarity:133/171 - (77%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAEDDELTLPRASINKIIKELVPTVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAE 76
            |..||:||:|||:|||:|||.:|.|||||::|||::|||:||||||||||||:||...||||:.|
  Rat     5 SGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPE 69

  Fly    77 HVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQA 141
            ||::|||.|||..|..|.:.||.:||.||.|||:.|:||||||||||||||||||||||||::||
  Rat    70 HVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQA 134

  Fly   142 REEQQQWMSMQAAAMVQRPPLADGSVASKPSEDDDDDDDDD 182
            ...||:|:.||.||...:...|..|.:::.....|:|||||
  Rat   135 ELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEDDDDD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 84/119 (71%)
Dr1NP_001011914.1 H4 7..130 CDD:419976 86/122 (70%)
Nuclear localization signal. /evidence=ECO:0000255 100..103 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343072
Domainoid 1 1.000 115 1.000 Domainoid score I5885
eggNOG 1 0.900 - - E1_COG5150
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38809
Inparanoid 1 1.050 221 1.000 Inparanoid score I3463
OMA 1 1.010 - - QHG55130
OrthoDB 1 1.010 - - D1465912at2759
OrthoFinder 1 1.000 - - FOG0004284
OrthoInspector 1 1.000 - - oto97244
orthoMCL 1 0.900 - - OOG6_103431
Panther 1 1.100 - - LDO PTHR46138
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3019
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.