DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and dpb4

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_595521.1 Gene:dpb4 / 2540966 PomBaseID:SPBC3D6.09 Length:210 Species:Schizosaccharomyces pombe


Alignment Length:199 Identity:43/199 - (21%)
Similarity:90/199 - (45%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAEDDELTLPRASINKIIKELVPTVR-VANESRELILNCCSEFIHLISSEANEVCNMRNKKTINA 75
            ::|.|:|.|||:.|.:::|.::|... |..|:.:.::|..:.|:..::|.:.|:....|:|.:..
pombe     9 TSELDDLALPRSIIMRLVKGVLPEKSLVQKEALKAMINSATLFVSFLTSASGEIATNNNRKILMP 73

  Fly    76 EHVLEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLG---------------IP---- 121
            :.||.||:.:.:.::.:..:..| :..|:|.|.:|  .:|.|:.               .|    
pombe    74 QDVLNALDEIEYPEFSKTLKKHL-EAYELALKEKR--LKLPNVSDVDNRKKAKIDAHDTTPLDEE 135

  Fly   122 ----EEELLRQ---QQELFAKAREEQAREEQQQWMSMQA-AAMVQRPPLADGSVASKPSEDDDDD 178
                |||.:.:   |.|:.....:.:..||....:...| :..::...|.|.:  ..|.||..:.
pombe   136 KDELEEERIAEDIAQNEVEQNIDDVEDLEEVNDTLDANAESPQIETIHLTDAT--GNPIEDSSES 198

  Fly   179 DDDD 182
            |.::
pombe   199 DSEE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 33/146 (23%)
dpb4NP_595521.1 H4 13..>109 CDD:304892 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.