DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and SPBC30D10.02

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_596283.1 Gene:SPBC30D10.02 / 2540406 PomBaseID:SPBC30D10.02 Length:161 Species:Schizosaccharomyces pombe


Alignment Length:125 Identity:59/125 - (47%)
Similarity:89/125 - (71%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDELTLPRASINKIIKELVPT-VRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINAEHV 78
            ||||:||:|::.|::.:::|. :....|:|:|::.||.|||||:||||||:|....||||.|||:
pombe     7 DDELSLPKATVQKMVSDILPVDLTFTKEARDLLIECCVEFIHLVSSEANEICEKEAKKTIAAEHI 71

  Fly    79 LEALERLGFHDYKQEAEAVLHDCKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKARE 138
            ::|||.|.|.:|..||..|..:.||....|.::|::.|..|:..:||||||:||.::|||
pombe    72 IKALENLEFKEYIAEALEVAAEHKEQQKNREKKSSKFEQSGVSRDELLRQQEELLSRARE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 56/120 (47%)
SPBC30D10.02NP_596283.1 COG5150 1..156 CDD:227479 59/125 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 75 1.000 Domainoid score I2487
eggNOG 1 0.900 - - E1_COG5150
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38809
Inparanoid 1 1.050 126 1.000 Inparanoid score I1451
OMA 1 1.010 - - QHG55130
OrthoFinder 1 1.000 - - FOG0004284
OrthoInspector 1 1.000 - - oto101323
orthoMCL 1 0.900 - - OOG6_103431
Panther 1 1.100 - - LDO PTHR46138
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R797
SonicParanoid 1 1.000 - - X3019
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.