DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NC2beta and Nfyb

DIOPT Version :9

Sequence 1:NP_609736.1 Gene:NC2beta / 34875 FlyBaseID:FBgn0028926 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_113741.1 Gene:Nfyb / 25336 RGDID:3172 Length:207 Species:Rattus norvegicus


Alignment Length:93 Identity:34/93 - (36%)
Similarity:57/93 - (61%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAEDDELTLPRASINKIIKELVP-TVRVANESRELILNCCSEFIHLISSEANEVCNMRNKKTINA 75
            |..:.::.||.|::.:|:|..:| |.::|.:::|.:..|.||||..|:|||:|.|:...:||||.
  Rat    51 SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTING 115

  Fly    76 EHVLEALERLGFHDYKQEAEAVLHDCKE 103
            |.:|.|:..|||..|.:..:..|...:|
  Rat   116 EDILFAMSTLGFDSYVEPLKLYLQKFRE 143

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
NC2betaNP_609736.1 H4 15..135 CDD:304892 33/90 (37%)