DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and yahD

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_414852.1 Gene:yahD / 947681 ECOCYCID:G6183 Length:201 Species:Escherichia coli


Alignment Length:92 Identity:29/92 - (31%)
Similarity:46/92 - (50%) Gaps:9/92 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVD-------MAKLLLQYHANPNART 112
            |..:..:|.|:|:|......||..::.|:|||..|...|  |       :.:|||::.|:|:...
E. coli   112 ACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLN--DGGIKQQAIVQLLLEHGASPHLTD 174

  Fly   113 ELGWTPLHSACKWNNADCAHLLLQFGA 139
            :.|.|||..|.:....:.|.||:..||
E. coli   175 KYGKTPLELARERGFEEIAQLLIAAGA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 7/23 (30%)
ANK 54..169 CDD:238125 29/92 (32%)
Ank_5 67..120 CDD:290568 18/59 (31%)
ANK repeat 81..112 CDD:293786 12/37 (32%)
Ank_5 100..154 CDD:290568 15/40 (38%)
ANK repeat 114..144 CDD:293786 10/26 (38%)
ANK repeat 147..180 CDD:293786
yahDNP_414852.1 ANKYR <4..146 CDD:223738 11/33 (33%)
ANK repeat 39..69 CDD:293786
ANK repeat 72..101 CDD:293786
ANK repeat 108..136 CDD:293786 7/23 (30%)
Ank_2 112..201 CDD:403870 27/90 (30%)
ANK repeat 138..174 CDD:293786 12/37 (32%)
ANK repeat 176..201 CDD:293786 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.