DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and ANKRD44

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001354424.1 Gene:ANKRD44 / 91526 HGNCID:25259 Length:1074 Species:Homo sapiens


Alignment Length:206 Identity:55/206 - (26%)
Similarity:78/206 - (37%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLL------------ 102
            |.:.||.....:..|..::...|: |..||..||||||.||.|..:::.|.||            
Human   175 RALHWAAYMGHLDVVALLINHGAE-VTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVY 238

  Fly   103 ---------------------QYHANPNARTELGWTPLH-SACKWNNADCAHLLLQFGADVNAES 145
                                 .|.||.|.....|:|||| :|...:.|.|..||:..|||||.:|
Human   239 GNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQS 303

  Fly   146 DGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEELASV---------IARRTGMSF---P 198
            ...::|||:||.......:.|::           .|..|:..|         :|.|.|...   .
Human   304 KDGKSPLHMTAVHGRFTRSQTLI-----------QNGGEIDCVDKDGNTPLHVAARYGHELLINT 357

  Fly   199 IFESGEEAYDC 209
            :..||.:...|
Human   358 LITSGADTAKC 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 5/26 (19%)
ANK 54..169 CDD:238125 45/148 (30%)
Ank_5 67..120 CDD:290568 23/85 (27%)
ANK repeat 81..112 CDD:293786 16/63 (25%)
Ank_5 100..154 CDD:290568 24/87 (28%)
ANK repeat 114..144 CDD:293786 15/30 (50%)
ANK repeat 147..180 CDD:293786 6/32 (19%)
ANKRD44NP_001354424.1 ANK 1 7..36
ANK 2 40..69
ANK 3 73..102
ANK 4 106..135
ANK 5 139..168
ANK 6 172..201 6/26 (23%)
ANK 7 205..234 12/28 (43%)
ANK 8 238..267 3/28 (11%)
ANK 9 271..301 14/29 (48%)
ANK 10 305..334 8/39 (21%)
ANK 11 338..367 5/28 (18%)
ANK 13 422..451
ANK 14 455..484
ANK 15 488..516
ANK 16 549..579
ANK 17 584..613
ANK 18 617..646
ANK 19 651..680
ANK 20 687..716
ANK 21 720..749
ANK 22 753..782
ANK 23 789..818
ANK 24 821..850
ANK 25 856..885
ANK 26 889..919
ANK 27 923..952
ANK 28 959..988
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.