DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and ASB13

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_078977.2	Gene:	ASB13 / 79754	HGNCID:	19765	Length:	278	Species:	Homo sapiens

Alignment Length:	82	Identity:	32/82 - (39%)
Similarity:	46/82 - (56%)	Gaps:	5/82 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 VNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHA--NPNARTELGWTPLHSACKWNNADCAHLLLQF 137
            |:|::.||.|||..|..:..::..||||.|.|  ||...|.   :|||.||...:::|..||:..
Human    78 VDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTA---SPLHEACMSGSSECVRLLIDV 139

  Fly   138 GADVNAESDGKQTPLHI 154
            ||::.|......||||:
Human   140 GANLEAHDCHFGTPLHV 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	2/3 (67%)
		ANK	54..169	CDD:238125	32/82 (39%)
		Ank_5	67..120	CDD:290568	18/46 (39%)
		ANK repeat	81..112	CDD:293786	14/32 (44%)
		Ank_5	100..154	CDD:290568	22/55 (40%)
		ANK repeat	114..144	CDD:293786	10/29 (34%)
		ANK repeat	147..180	CDD:293786	4/8 (50%)
ASB13	NP_078977.2	ANK 1	18..47
		Ank_4	19..72	CDD:290365
		ANK repeat	20..49	CDD:293786
		ANK	46..170	CDD:238125	32/82 (39%)
		ANK repeat	51..82	CDD:293786	2/3 (67%)
		ANK 2	51..80		1/1 (100%)
		Ank_2	56..147	CDD:289560	28/71 (39%)
		ANK 3	84..113		12/28 (43%)
		ANK repeat	84..112	CDD:293786	12/27 (44%)
		ANK 4	116..145		11/31 (35%)
		ANK repeat	119..147	CDD:293786	11/27 (41%)
		Ank_2	121..212	CDD:289560	14/36 (39%)
		ANK repeat	149..179	CDD:293786	4/8 (50%)
		ANK 5	149..178		4/8 (50%)
		ANK repeat	181..212	CDD:293786
		ANK 6	181..210
		ANK	183..>215	CDD:238125
		SOCS_ASB13	237..278	CDD:239699
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1546307at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010