| Sequence 1: | NP_609735.1 | Gene: | l(2)35Be / 34874 | FlyBaseID: | FBgn0261881 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006514154.1 | Gene: | Ankrd24 / 70615 | MGIID: | 1890394 | Length: | 1088 | Species: | Mus musculus |
| Alignment Length: | 213 | Identity: | 54/213 - (25%) |
|---|---|---|---|
| Similarity: | 77/213 - (36%) | Gaps: | 52/213 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 49 ERMILWAVNENRISEVREIL--------KLDAD-------------------------TVNAKDN 80
Fly 81 DGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAES 145
Fly 146 DGKQTPLHITATVSNCRNTATVLLL-------DRYIQPRK------ENNSEELASVIARRTGMSF 197
Fly 198 PIFES-GEEA--YDCETG 212 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(2)35Be | NP_609735.1 | ANK repeat | 52..79 | CDD:293786 | 9/59 (15%) |
| ANK | 54..169 | CDD:238125 | 36/147 (24%) | ||
| Ank_5 | 67..120 | CDD:290568 | 17/85 (20%) | ||
| ANK repeat | 81..112 | CDD:293786 | 9/30 (30%) | ||
| Ank_5 | 100..154 | CDD:290568 | 17/53 (32%) | ||
| ANK repeat | 114..144 | CDD:293786 | 12/29 (41%) | ||
| ANK repeat | 147..180 | CDD:293786 | 12/45 (27%) | ||
| Ankrd24 | XP_006514154.1 | ANK repeat | 70..97 | CDD:293786 | 6/26 (23%) |
| PHA02875 | 73..>260 | CDD:165206 | 47/189 (25%) | ||
| ANK repeat | 99..130 | CDD:293786 | 1/30 (3%) | ||
| ANK repeat | 133..163 | CDD:293786 | 9/29 (31%) | ||
| Ank_2 | 137..229 | CDD:372319 | 29/93 (31%) | ||
| ANK repeat | 165..196 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 198..229 | CDD:293786 | 10/32 (31%) | ||
| PTZ00322 | 207..>328 | CDD:140343 | 19/73 (26%) | ||
| ANK repeat | 231..262 | CDD:293786 | 8/31 (26%) | ||
| SMC_prok_B | <342..1042 | CDD:274008 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||