DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and Asb11

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_001300666.1	Gene:	Asb11 / 68854	MGIID:	1916104	Length:	323	Species:	Mus musculus

Alignment Length:	182	Identity:	46/182 - (25%)
Similarity:	69/182 - (37%)	Gaps:	68/182 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly    27 VSGWDDDADELIEE----------DKNPQS---------SIERMILWAVNENRISEVREILKLDA 72
            |.|...:|..:.||          |::|..         :::.:|...:|.|.:
Mouse    41 VKGNRKEAARIAEEIYGGLSDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLV----------- 94

  Fly    73 DTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQF 137
             |:|.     .:.||.|.....|..||.||:..|:.||:|..|.|||.:||...:|.|.::||:|
Mouse    95 -TINR-----VSSLHEACLGGHVACAKALLENGAHVNAQTVHGATPLFNACCSGSAACVNVLLEF 153

  Fly   138 GA------------------------------DVNAESDGKQ--TPLHITAT 157
            ||                              |||.|.:..|  |||::..|
Mouse   154 GAKAQLEIYLASPIHEAVKRGHRECMEILLTKDVNIEQEVPQLGTPLYVACT 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	5/26 (19%)
		ANK	54..169	CDD:238125	38/136 (28%)
		Ank_5	67..120	CDD:290568	17/52 (33%)
		ANK repeat	81..112	CDD:293786	11/30 (37%)
		Ank_5	100..154	CDD:290568	27/85 (32%)
		ANK repeat	114..144	CDD:293786	16/59 (27%)
		ANK repeat	147..180	CDD:293786	5/13 (38%)
Asb11	NP_001300666.1	ANK 1	64..93		4/28 (14%)
		ANK	66..183	CDD:238125	31/133 (23%)
		Ank_4	66..118	CDD:290365	12/68 (18%)
		ANK repeat	66..95	CDD:293786	4/40 (10%)
		ANK repeat	97..128	CDD:293786	12/35 (34%)
		ANK 2	97..126		10/33 (30%)
		Ank_2	102..189	CDD:289560	27/86 (31%)
		ANK 3	130..159		13/28 (46%)
		ANK repeat	130..155	CDD:293786	11/24 (46%)
		ANK 4	162..191		3/28 (11%)
		ANK	165..269	CDD:238125	9/41 (22%)
		ANK repeat	165..193	CDD:293786	4/27 (15%)
		Ank_2	167..258	CDD:289560	9/39 (23%)
		ANK repeat	195..225	CDD:293786	5/11 (45%)
		ANK 5	195..224		5/11 (45%)
		ANK repeat	227..258	CDD:293786
		ANK 6	227..256
		ANK 7	260..289
		SOCS	282..323	CDD:295349
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1546307at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010