DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and Asb1

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_001034215.1	Gene:	Asb1 / 65247	MGIID:	1929735	Length:	336	Species:	Mus musculus

Alignment Length:	105	Identity:	28/105 - (26%)
Similarity:	47/105 - (44%)	Gaps:	18/105 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 DADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLL 135
            :.|.|:.|   |.|.|:.|..|..::..::||:..|:||.......||::.|.:....|....|:
Mouse   104 EVDLVDVK---GQTALYVAVVNGHLESTEILLEAGADPNGSRHHRSTPVYHASRVGRDDILKALI 165

  Fly   136 QFGADVNAE----SDGKQ-----------TPLHITATVSN 160
            ::||||:..    .|.:.           .||:|:|...|
Mouse   166 RYGADVDVNHHLTPDTRPPFSRRLTSLVVCPLYISAAYHN 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	2/7 (29%)
		ANK	54..169	CDD:238125	28/105 (27%)
		Ank_5	67..120	CDD:290568	15/48 (31%)
		ANK repeat	81..112	CDD:293786	10/30 (33%)
		Ank_5	100..154	CDD:290568	17/68 (25%)
		ANK repeat	114..144	CDD:293786	9/29 (31%)
		ANK repeat	147..180	CDD:293786	5/25 (20%)
Asb1	NP_001034215.1	ANK 1	37..69
		Ank_4	40..99	CDD:290365
		ANK repeat	42..71	CDD:293786
		ANK 2	78..107		0/2 (0%)
		ANK	80..213	CDD:238125	28/105 (27%)
		ANK repeat	80..109	CDD:293786	1/4 (25%)
		Ank_2	83..174	CDD:289560	22/72 (31%)
		ANK repeat	111..142	CDD:293786	11/33 (33%)
		ANK 3	111..140		10/31 (32%)
		ANK repeat	144..173	CDD:293786	9/28 (32%)
		ANK 4	144..173		9/28 (32%)
		ANK repeat	175..220	CDD:293786	6/31 (19%)
		ANK 5	192..221		5/14 (36%)
		ANK 6	236..266
		SOCS_ASB1	295..336	CDD:239690
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910