DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and CASKIN1

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_065815.1 Gene:CASKIN1 / 57524 HGNCID:20879 Length:1431 Species:Homo sapiens


Alignment Length:200 Identity:53/200 - (26%)
Similarity:81/200 - (40%) Gaps:54/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ELIEEDKNPQSSIE-------RMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNN 93
            |||......|::::       |.:.:|..:.|...::.:||. ...||...::|:.|||.||.:.
Human    63 ELISLLLEAQAAVDIKDNKGMRPLHYAAWQGRKEPMKLVLKA-GSAVNIPSDEGHIPLHLAAQHG 126

  Fly    94 FVDMAKLLLQYHANP-----NARTEL------------------------------------GWT 117
            ..|::::|||:.:||     :.:|.|                                    |.:
Human   127 HYDVSEMLLQHQSNPCMVDNSGKTPLDLACEFGRVGVVQLLLSSNMCAALLEPRPGDATDPNGTS 191

  Fly   118 PLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATV-LLLDRYIQPRKENN 181
            |||.|.|..:.|...||||.|.|:|.::. ..|.||..|.   |..|..| ||||..|.....|.
Human   192 PLHLAAKNGHIDIIRLLLQAGIDINRQTK-SGTALHEAAL---CGKTEVVRLLLDSGINAHVRNT 252

  Fly   182 SEELA 186
            ..:.|
Human   253 YSQTA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 6/26 (23%)
ANK 54..169 CDD:238125 41/156 (26%)
Ank_5 67..120 CDD:290568 20/93 (22%)
ANK repeat 81..112 CDD:293786 12/35 (34%)
Ank_5 100..154 CDD:290568 23/94 (24%)
ANK repeat 114..144 CDD:293786 15/65 (23%)
ANK repeat 147..180 CDD:293786 12/33 (36%)
CASKIN1NP_065815.1 Ank_4 7..69 CDD:290365 3/5 (60%)
ANK repeat 7..46 CDD:293786
ANK 43..168 CDD:238125 25/105 (24%)
ANK repeat 48..79 CDD:293786 4/15 (27%)
ANK 1 48..77 4/13 (31%)
Ank_2 53..145 CDD:289560 23/82 (28%)
ANK repeat 81..112 CDD:293786 7/31 (23%)
ANK 2 81..110 6/29 (21%)
ANK 109..241 CDD:238125 37/135 (27%)
ANK repeat 114..145 CDD:293786 12/30 (40%)
ANK 3 114..143 12/28 (43%)
Ank_2 119..218 CDD:289560 26/98 (27%)
ANK repeat 147..186 CDD:293786 2/38 (5%)
ANK 4 147..176 2/28 (7%)
ANK repeat 188..218 CDD:293786 14/29 (48%)
ANK 5 188..217 13/28 (46%)
Ank_5 208..261 CDD:290568 19/53 (36%)
ANK 6 220..249 12/32 (38%)
ANK repeat 221..251 CDD:293786 12/32 (38%)
ANK repeat 253..287 CDD:293786 0/4 (0%)
SH3_Caskin1 284..345 CDD:212995
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..373
Caskin1-CID 373..421 CDD:293208
CASK-binding. /evidence=ECO:0000250 375..469
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..447
SAM 470..532 CDD:197735
SAM_caskin1,2_repeat1 471..536 CDD:188896
SAM_caskin1,2_repeat2 537..607 CDD:188897
SAM 549..604 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 630..977
Ten_N <651..>809 CDD:284015
Caskin-Pro-rich 876..947 CDD:293512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1014..1039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1072..1377
Caskin-tail 1370..1431 CDD:293238
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1390..1416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.