DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and ANKS1B

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	NP_001339115.1	Gene:	ANKS1B / 56899	HGNCID:	24600	Length:	1285	Species:	Homo sapiens

Alignment Length:	122	Identity:	39/122 - (31%)
Similarity:	59/122 - (48%)	Gaps:	5/122 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 VNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFG- 138
            ||..|:.|||.||.||.|...|:...||||.|:.|.....|:.|:|.|....:.:...:|:..|
Human    52 VNCTDSSGYTALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGP 116

  Fly   139 --ADVNAESDGKQTPLHITATVSNCRNTATVL--LLDRYIQPRKENNSEELASVIAR 191
              :.||.:::..:|.||..|...:....|.:|  |.|..|:..|.....:||::..|
Human   117 SHSRVNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGR 173

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	2/3 (67%)
		ANK	54..169	CDD:238125	32/98 (33%)
		Ank_5	67..120	CDD:290568	20/44 (45%)
		ANK repeat	81..112	CDD:293786	15/30 (50%)
		Ank_5	100..154	CDD:290568	16/56 (29%)
		ANK repeat	114..144	CDD:293786	8/32 (25%)
		ANK repeat	147..180	CDD:293786	10/34 (29%)
ANKS1B	NP_001339115.1	ANK repeat	7..56	CDD:293786	2/3 (67%)
		ANK	53..181	CDD:238125	38/121 (31%)
		ANK repeat	58..89	CDD:293786	15/30 (50%)
		ANK repeat	91..125	CDD:293786	8/33 (24%)
		ANK	122..246	CDD:238125	14/52 (27%)
		ANK repeat	127..158	CDD:293786	9/30 (30%)
		ANK repeat	160..191	CDD:293786	4/14 (29%)
		ANK repeat	193..223	CDD:293786
		ANK repeat	226..256	CDD:293786
		SAM_AIDA1AB-like_repeat1	811..877	CDD:188898
		SAM_AIDA1AB-like_repeat2	882..946	CDD:188899
		PTB_Anks	1071..1220	CDD:269972
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910