| Sequence 1: | NP_609735.1 | Gene: | l(2)35Be / 34874 | FlyBaseID: | FBgn0261881 | Length: | 215 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001122202.1 | Gene: | ankrd67 / 566073 | ZFINID: | ZDB-GENE-050419-160 | Length: | 422 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 58/201 - (28%) |
|---|---|---|---|
| Similarity: | 84/201 - (41%) | Gaps: | 43/201 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 GWDDDADEL------IEEDKNPQSSIERMILWAVNENRISEVREILKLDADT------------- 74
Fly 75 -------------------VNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLH 120
Fly 121 SACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKENNSEEL 185
Fly 186 ASVIAR 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| l(2)35Be | NP_609735.1 | ANK repeat | 52..79 | CDD:293786 | 8/58 (14%) |
| ANK | 54..169 | CDD:238125 | 41/146 (28%) | ||
| Ank_5 | 67..120 | CDD:290568 | 18/84 (21%) | ||
| ANK repeat | 81..112 | CDD:293786 | 9/30 (30%) | ||
| Ank_5 | 100..154 | CDD:290568 | 24/53 (45%) | ||
| ANK repeat | 114..144 | CDD:293786 | 15/29 (52%) | ||
| ANK repeat | 147..180 | CDD:293786 | 10/32 (31%) | ||
| ankrd67 | NP_001122202.1 | Ank_4 | 55..104 | CDD:290365 | |
| ANK repeat | 55..81 | CDD:293786 | |||
| ANK | 78..204 | CDD:238125 | 4/8 (50%) | ||
| ANK repeat | 83..115 | CDD:293786 | |||
| Ank_2 | 89..181 | CDD:289560 | |||
| ANK repeat | 119..148 | CDD:293786 | |||
| ANK repeat | 150..181 | CDD:293786 | |||
| Ank_2 | 155..246 | CDD:289560 | 15/53 (28%) | ||
| ANK repeat | 183..211 | CDD:293786 | 5/15 (33%) | ||
| ANK repeat | 216..246 | CDD:293786 | 8/32 (25%) | ||
| ANK | 217..245 | CDD:197603 | 8/30 (27%) | ||
| ANK | 244..369 | CDD:238125 | 34/126 (27%) | ||
| ANK repeat | 249..280 | CDD:293786 | 1/30 (3%) | ||
| Ank_4 | 250..303 | CDD:290365 | 9/52 (17%) | ||
| ANK repeat | 285..313 | CDD:293786 | 8/27 (30%) | ||
| Ank_2 | 287..378 | CDD:289560 | 34/92 (37%) | ||
| ANK repeat | 315..346 | CDD:293786 | 16/30 (53%) | ||
| ANK | 343..>404 | CDD:238125 | 17/50 (34%) | ||
| ANK repeat | 348..378 | CDD:293786 | 10/31 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||