DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)35Be and Ankrd49

DIOPT Version :9

Sequence 1:NP_609735.1 Gene:l(2)35Be / 34874 FlyBaseID:FBgn0261881 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001335189.1 Gene:Ankrd49 / 56503 MGIID:1930842 Length:238 Species:Mus musculus


Alignment Length:226 Identity:91/226 - (40%)
Similarity:132/226 - (58%) Gaps:31/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DDEK-------------SQVEKLR-HAK-VPRG---MFVSGWDDDADELIEEDKNP--------- 44
            ||||             :|:|.|: |.. :|.|   ::|...|:|.:   :|:||.         
Mouse     7 DDEKPDLENSVDFSEQFNQLELLKTHGHLIPTGTQSLWVGNSDEDEE---QEEKNEEWYQLQEKK 68

  Fly    45 -QSSIERMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANP 108
             :....:::|||..:||::.|:.:|...|..||.:|.|.|||||||||:..:|:.:.|:...|:.
Mouse    69 MEKDPSKLLLWAAEKNRLATVQRLLSEKAAEVNTRDEDEYTPLHRAAYSGHIDVVRELVAKGADV 133

  Fly   109 NARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRY 173
            :|.|..|||||||||||||...|..|||..||:||::.|..||||:.|...:.|:|..:||::||
Mouse   134 HAVTVDGWTPLHSACKWNNTKVASFLLQHDADINAQTKGLLTPLHLAAGNRDSRDTLELLLMNRY 198

  Fly   174 IQPRKENNSEELASVIARRTGMSFPIFESGE 204
            |:|..:|||:|.||.|||||.:...:||..|
Mouse   199 IKPELKNNSQETASDIARRTSIYHYLFEIAE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)35BeNP_609735.1 ANK repeat 52..79 CDD:293786 10/26 (38%)
ANK 54..169 CDD:238125 54/114 (47%)
Ank_5 67..120 CDD:290568 24/52 (46%)
ANK repeat 81..112 CDD:293786 14/30 (47%)
Ank_5 100..154 CDD:290568 29/53 (55%)
ANK repeat 114..144 CDD:293786 20/29 (69%)
ANK repeat 147..180 CDD:293786 14/32 (44%)
Ankrd49NP_001335189.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..57 5/21 (24%)
ANK 1 72..105 10/32 (31%)
Ank_2 77..169 CDD:372319 46/91 (51%)
ANK repeat 77..104 CDD:293786 10/26 (38%)
ANK repeat 106..137 CDD:293786 14/30 (47%)
ANK 2 106..135 13/28 (46%)
ANK repeat 139..169 CDD:293786 20/29 (69%)
ANK 3 139..168 19/28 (68%)
ANK 4 172..205 14/32 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845698
Domainoid 1 1.000 55 1.000 Domainoid score I11110
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9787
Inparanoid 1 1.050 157 1.000 Inparanoid score I4266
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48821
OrthoDB 1 1.010 - - D1546307at2759
OrthoFinder 1 1.000 - - FOG0007458
OrthoInspector 1 1.000 - - oto93775
orthoMCL 1 0.900 - - OOG6_107702
Panther 1 1.100 - - LDO PTHR24144
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4168
SonicParanoid 1 1.000 - - X5588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.