DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(2)35Be and caskin2

DIOPT Version :9

Sequence 1:	NP_609735.1	Gene:	l(2)35Be / 34874	FlyBaseID:	FBgn0261881	Length:	215	Species:	Drosophila melanogaster
Sequence 2:	XP_009304988.1	Gene:	caskin2 / 564253	ZFINID:	ZDB-GENE-041001-137	Length:	1308	Species:	Danio rerio

Alignment Length:	121	Identity:	41/121 - (33%)
Similarity:	58/121 - (47%)	Gaps:	3/121 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    36 ELIEEDKNPQSSIERMILWAVNENRISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKL 100
            :|:...||....:...:|..:..||...:....:|:   ||.:|.||::.||.||.....|:..|
Zfish     6 DLLLAVKNGDLPLAHKLLAKIKTNRNKLLGSTKRLN---VNYQDQDGFSALHHAALTGTTDLLSL 67

  Fly   101 LLQYHANPNARTELGWTPLHSACKWNNADCAHLLLQFGADVNAESDGKQTPLHITA 156
            ||:..|..:.:...|..|||.|.....||...|||:.||.||..|...|.|||:.|
Zfish    68 LLEAQATVDIKDSNGMRPLHYAAWQGKADSVLLLLRAGASVNGASHDGQIPLHLAA 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(2)35Be	NP_609735.1	ANK repeat	52..79	CDD:293786	6/26 (23%)
		ANK	54..169	CDD:238125	37/103 (36%)
		Ank_5	67..120	CDD:290568	17/52 (33%)
		ANK repeat	81..112	CDD:293786	11/30 (37%)
		Ank_5	100..154	CDD:290568	22/53 (42%)
		ANK repeat	114..144	CDD:293786	14/29 (48%)
		ANK repeat	147..180	CDD:293786	5/10 (50%)
caskin2	XP_009304988.1	Ank_4	7..69	CDD:290365	18/64 (28%)
		ANK repeat	7..46	CDD:293786	9/41 (22%)
		ANK	43..168	CDD:238125	33/81 (41%)
		ANK repeat	48..79	CDD:293786	11/30 (37%)
		Ank_2	53..145	CDD:289560	29/71 (41%)
		ANK repeat	81..112	CDD:293786	14/30 (47%)
		ANK	114..235	CDD:238125	5/10 (50%)
		ANK repeat	114..145	CDD:293786	5/10 (50%)
		Ank_2	152..245	CDD:289560
		ANK repeat	158..213	CDD:293786
		ANK repeat	215..245	CDD:293786
		ANK repeat	247..281	CDD:293786
		SH3_Caskin2	278..339	CDD:212996
		Caskin1-CID	414..>451	CDD:293208
		SAM_caskin1,2_repeat1	536..600	CDD:188896
		SAM	537..589	CDD:197735
		SAM_caskin1,2_repeat2	601..671	CDD:188897
		SAM	607..668	CDD:197735
		Caskin-Pro-rich	904..991	CDD:293512
		Caskin-tail	1248..1308	CDD:293238
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910